PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G28910.1
Common NameATMYB30, hsr1, MLD15.8, MYB30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 323aa    MW: 35918.9 Da    PI: 8.068
Description myb domain protein 30
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G28910.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
      AT3G28910.1 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.26e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
      AT3G28910.1  67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.078961IPR017930Myb domain
SuperFamilySSF466891.91E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002495.6E-161461IPR001005SANT/Myb domain
CDDcd001679.55E-111661No hitNo description
PROSITE profilePS5129423.73962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2465117IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.1E-1467112IPR001005SANT/Myb domain
CDDcd001672.74E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000263anatomynon-hair root epidermal cell
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MVRPPCCDKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKVN  120
QDSHQELDRS SLSSSPSSSS ANSNSNISRG QWERRLQTDI HLAKKALSEA LSPAVAPIIT  180
STVTTTSSSA ESRRSTSSAS GFLRTQETST TYASSTENIA KLLKGWVKNS PKTQNSADQI  240
ASTEVKEVIK SDDGKECAGA FQSFSEFDHS YQQAGVSPDH ETKPDITGCC SNQSQWSLFE  300
KWLFEDSGGQ IGDILLDENT NFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
1h89_C6e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-251411658159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109020.0flower| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453390460.0
Genevisible257140_at0.0
Expression AtlasAT3G28910-
AtGenExpressAT3G28910-
ATTED-IIAT3G28910-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in 2-week-old seedlings, in the early stages of development. {ECO:0000269|PubMed:10571865}.
UniprotTISSUE SPECIFICITY: Expressed in vascular tissues of leaves, hypocotyl and roots. {ECO:0000269|PubMed:24587042}.
Functional Description ? help Back to Top
Source Description
TAIRtranscription factor myb homologue
UniProtTranscription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}.
Function -- GeneRIF ? help Back to Top
  1. BES1 and AtMYB30 function cooperatively to promote brassinosteroid target gene expression.
    [PMID: 19170933]
  2. Results suggest that RNA silencing directly mediates downregulation of AtMYB30 expression, both in young seedlings and in adult plants.
    [PMID: 20605724]
  3. AtMYB30 and the secreted phospholipase AtsPLA(2)-alpha physically interact in vivo, following the AtMYB30-mediated specific relocalization of AtsPLA(2)-alpha from cytoplasmic vesicles to the plant cell nucleus.
    [PMID: 20696912]
  4. XopD relocalizes Arabidopsis MYB30 to nuclear foci and represses MYB30 transcriptional activity.
    [PMID: 21917550]
  5. coordination of ABI5 and MYB30 sumoylation by SIZ1 may balance gene expression, which is required for regulation of ABA signaling during seed germination.
    [PMID: 22814374]
  6. MIEL1 (MYB30-Interacting E3 Ligase1), an Arabidopsis RING-type E3 ubiquitin ligase that interacts with and ubiquitinates MYB30, leads to MYB30 proteasomal degradation and downregulation of its transcriptional activity.
    [PMID: 23403577]
  7. S-nitrosylation influences the structure and DNA binding activity of MYB30 from Arabidopsis thaliana.
    [PMID: 24583075]
  8. Elevated levels of MYB30 in the phloem accelerate flowering in Arabidopsis through the regulation of FLOWERING LOCUS T.
    [PMID: 24587042]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G28910.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G01120(A), AT1G02205(A), AT1G04220(A), AT1G74710(A), AT2G26250(A), AT4G33790(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, Brassinosteroid, ethylene, gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G19350
IntActSearch Q9SCU7
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Altered brassinosteroids response phenotypes (PubMed:19170933). Hypersensitivity to ABA during germination and seedling growth (PubMed:22814374). {ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:22814374}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G28910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2503390.0AF250339.1 Arabidopsis thaliana Myb30 (Myb30) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189533.10.0myb domain protein 30
SwissprotQ9SCU70.0MYB30_ARATH; Transcription factor MYB30
TrEMBLQ9SBG30.0Q9SBG3_ARATH; Putative transcription factor
STRINGAT3G28910.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Daniel X,Lacomme C,Morel JB,Roby D
    A novel myb oncogene homologue in Arabidopsis thaliana related to hypersensitive cell death.
    Plant J., 1999. 20(1): p. 57-66
    [PMID:10571865]
  2. Kleinow T, et al.
    Functional identification of an Arabidopsis snf4 ortholog by screening for heterologous multicopy suppressors of snf4 deficiency in yeast.
    Plant J., 2000. 23(1): p. 115-22
    [PMID:10929106]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  5. Vailleau F, et al.
    A R2R3-MYB gene, AtMYB30, acts as a positive regulator of the hypersensitive cell death program in plants in response to pathogen attack.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(15): p. 10179-84
    [PMID:12119395]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  8. Raffaele S,Rivas S,Roby D
    An essential role for salicylic acid in AtMYB30-mediated control of the hypersensitive cell death program in Arabidopsis.
    FEBS Lett., 2006. 580(14): p. 3498-504
    [PMID:16730712]
  9. Raffaele S, et al.
    A MYB transcription factor regulates very-long-chain fatty acid biosynthesis for activation of the hypersensitive cell death response in Arabidopsis.
    Plant Cell, 2008. 20(3): p. 752-67
    [PMID:18326828]
  10. Li L, et al.
    Arabidopsis MYB30 is a direct target of BES1 and cooperates with BES1 to regulate brassinosteroid-induced gene expression.
    Plant J., 2009. 58(2): p. 275-86
    [PMID:19170933]
  11. Okada S, et al.
    Reconstitution of Arabidopsis thaliana SUMO pathways in E. coli: functional evaluation of SUMO machinery proteins and mapping of SUMOylation sites by mass spectrometry.
    Plant Cell Physiol., 2009. 50(6): p. 1049-61
    [PMID:19376783]
  12. Reina-Pinto JJ, et al.
    Misexpression of FATTY ACID ELONGATION1 in the Arabidopsis epidermis induces cell death and suggests a critical role for phospholipase A2 in this process.
    Plant Cell, 2009. 21(4): p. 1252-72
    [PMID:19376931]
  13. Froidure S,Roby D,Rivas S
    Expression of the Arabidopsis transcription factor AtMYB30 is post-transcriptionally regulated.
    Plant Physiol. Biochem., 2010. 48(8): p. 735-9
    [PMID:20605724]
  14. Froidure S, et al.
    AtsPLA2-alpha nuclear relocalization by the Arabidopsis transcription factor AtMYB30 leads to repression of the plant defense response.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(34): p. 15281-6
    [PMID:20696912]
  15. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  16. Canonne J, et al.
    The Xanthomonas type III effector XopD targets the Arabidopsis transcription factor MYB30 to suppress plant defense.
    Plant Cell, 2011. 23(9): p. 3498-511
    [PMID:21917550]
  17. Bruex A, et al.
    A gene regulatory network for root epidermis cell differentiation in Arabidopsis.
    PLoS Genet., 2012. 8(1): p. e1002446
    [PMID:22253603]
  18. Canonne J, et al.
    Identification of the protein sequence of the type III effector XopD from the B100 strain of Xanthomonas campestris pv campestris.
    Plant Signal Behav, 2012. 7(2): p. 184-7
    [PMID:22353870]
  19. Zheng Y,Schumaker KS,Guo Y
    Sumoylation of transcription factor MYB30 by the small ubiquitin-like modifier E3 ligase SIZ1 mediates abscisic acid response in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(31): p. 12822-7
    [PMID:22814374]
  20. Marino D, et al.
    Arabidopsis ubiquitin ligase MIEL1 mediates degradation of the transcription factor MYB30 weakening plant defence.
    Nat Commun, 2013. 4: p. 1476
    [PMID:23403577]
  21. Li-Beisson Y, et al.
    Acyl-lipid metabolism.
    Arabidopsis Book, 2013. 11: p. e0161
    [PMID:23505340]
  22. Raffaele S,Rivas S
    Regulate and be regulated: integration of defense and other signals by the AtMYB30 transcription factor.
    Front Plant Sci, 2013. 4: p. 98
    [PMID:23596456]
  23. Tavares CP, et al.
    S-nitrosylation influences the structure and DNA binding activity of AtMYB30 transcription factor from Arabidopsis thaliana.
    Biochim. Biophys. Acta, 2014. 1844(4): p. 810-7
    [PMID:24583075]
  24. Liu L, et al.
    Elevated levels of MYB30 in the phloem accelerate flowering in Arabidopsis through the regulation of FLOWERING LOCUS T.
    PLoS ONE, 2014. 9(2): p. e89799
    [PMID:24587042]
  25. Xie LJ, et al.
    Arabidopsis acyl-CoA-binding protein ACBP3 participates in plant response to hypoxia by modulating very-long-chain fatty acid metabolism.
    Plant J., 2015. 81(1): p. 53-67
    [PMID:25284079]
  26. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]